Lineage for d1dy0a_ (1dy0 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. Family d.169.1.5: Endostatin [56480] (2 proteins)
    decorated with many insertions in the common fold
    automatically mapped to Pfam PF06482
  6. Protein Endostatin [56481] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [56483] (3 PDB entries)
  8. Domain d1dy0a_: 1dy0 A: [42449]
    complexed with zn

Details for d1dy0a_

PDB Entry: 1dy0 (more details), 2.2 Å

PDB Description: murine endostatin, crystal form ii
PDB Compounds: (A:) collagen alpha1(xviii) chain

SCOPe Domain Sequences for d1dy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dy0a_ d.169.1.5 (A:) Endostatin {Mouse (Mus musculus) [TaxId: 10090]}
ahthqdfqpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqdlys
ivrradrgsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpqksv
whgsdpsgrrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlciensfm

SCOPe Domain Coordinates for d1dy0a_ are not available.

Timeline for d1dy0a_: