SCOPe 2.08: Domain d1koea_: 1koe A:

Lineage for d1koea_ (1koe A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.5: Endostatin [56480] (2 proteins)
   decorated with many insertions in the common fold
   automatically mapped to Pfam PF06482

6. Protein Endostatin [56481] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56483] (3 PDB entries)

8. Domain d1koea_: 1koe A: [42448]

Details for d1koea_

PDB Entry: 1koe, 1.5 Å

PDB Description: endostatin

PDB Compounds: (A:) endostatin

SCOPe Domain Sequences for d1koea_:

Sequence; same for both SEQRES and ATOM records:

>d1koea_ d.169.1.5 (A:) Endostatin {Mouse (Mus musculus) [TaxId: 10090]}
qpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqdlysivrradr
gsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpqksvwhgsdps
grrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlciensf

Timeline for d1koea_:

• d1koea_ first appeared (with stable ids) in SCOP 1.55, called d1koe__
  
• d1koea_ appears in SCOPe 2.07