SCOPe 2.08: Domain d1bnld_: 1bnl D:

Lineage for d1bnld_ (1bnl D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.5: Endostatin [56480] (2 proteins)
   decorated with many insertions in the common fold
   automatically mapped to Pfam PF06482

6. Protein Endostatin [56481] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56482] (1 PDB entry)

8. Domain d1bnld_: 1bnl D: [42447]
   complexed with zn

Details for d1bnld_

PDB Entry: 1bnl, 2.9 Å

PDB Description: zinc dependent dimers observed in crystals of human endostatin

PDB Compounds: (D:) collagen xviii

SCOPe Domain Sequences for d1bnld_:

Sequence; same for both SEQRES and ATOM records:

>d1bnld_ d.169.1.5 (D:) Endostatin {Human (Homo sapiens) [TaxId: 9606]}
hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf

Timeline for d1bnld_:

• d1bnld_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnld_ appears in SCOPe 2.07