SCOP 1.65: Domain d1bnlb_: 1bnl B:

Lineage for d1bnlb_ (1bnl B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.5: Endostatin [56480] (2 proteins)
   decorated with many insertions in the common fold

6. Protein Endostatin [56481] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56482] (1 PDB entry)

8. Domain d1bnlb_: 1bnl B: [42445]

Details for d1bnlb_

PDB Entry: 1bnl, 2.9 Å

PDB Description: zinc dependent dimers observed in crystals of human endostatin

SCOP Domain Sequences for d1bnlb_:

Sequence; same for both SEQRES and ATOM records:

>d1bnlb_ d.169.1.5 (B:) Endostatin {Human (Homo sapiens)}
hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf

Timeline for d1bnlb_:

• d1bnlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnlb_ appears in SCOP 1.63
  
• d1bnlb_ appears in SCOP 1.67
  
• d1bnlb_ appears in the current release, SCOPe 2.08