Lineage for d1tsg__ (1tsg -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (6 families) 
Family d.169.1.4: Link domain [56477] (1 protein) Protein TSG-6, Link module [56478] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56479] (1 PDB entry) 
Domain d1tsg__: 1tsg - [42443]
Details for d1tsg__
PDB Entry: 1tsg (more details)
PDB Description: nmr study of the link module from tsg-6, minimized average structure
SCOP Domain Sequences for d1tsg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tsg__ d.169.1.4 (-) TSG-6, Link module {Human (Homo sapiens)}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak
SCOP Domain Coordinates for d1tsg__:
Click to download the PDB-style file with coordinates for d1tsg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tsg__:
- d1tsg__ first appeared (with stable ids) in SCOP 1.55
- d1tsg__ appears in SCOP 1.59
- d1tsg__ appears in SCOP 1.63
- d1tsg__ last appears in SCOP 1.65
View in 3D