Lineage for d1tsg__ (1tsg -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85774Family d.169.1.4: Link domain [56477] (1 protein)
  6. 85775Protein TSG-6, Link module [56478] (1 species)
  7. 85776Species Human (Homo sapiens) [TaxId:9606] [56479] (1 PDB entry)
  8. 85777Domain d1tsg__: 1tsg - [42443]

Details for d1tsg__

PDB Entry: 1tsg (more details)

PDB Description: nmr study of the link module from tsg-6, minimized average structure

SCOP Domain Sequences for d1tsg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsg__ d.169.1.4 (-) TSG-6, Link module {Human (Homo sapiens)}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak

SCOP Domain Coordinates for d1tsg__:

Click to download the PDB-style file with coordinates for d1tsg__.
(The format of our PDB-style files is described here.)

Timeline for d1tsg__: