Lineage for d1cwva5 (1cwv A:887-986)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941091Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins)
    automatically mapped to Pfam PF07979
  6. 1941097Protein Invasin [56475] (1 species)
  7. 1941098Species Yersinia pseudotuberculosis [TaxId:633] [56476] (1 PDB entry)
  8. 1941099Domain d1cwva5: 1cwv A:887-986 [42442]
    Other proteins in same PDB: d1cwva1, d1cwva2, d1cwva3, d1cwva4
    complexed with cit

Details for d1cwva5

PDB Entry: 1cwv (more details), 2.3 Å

PDB Description: crystal structure of invasin: a bacterial integrin-binding protein
PDB Compounds: (A:) invasin

SCOPe Domain Sequences for d1cwva5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwva5 d.169.1.3 (A:887-986) Invasin {Yersinia pseudotuberculosis [TaxId: 633]}
nrwiydggrslvssleasrqcqgsdmsavlessratngtrapdgtlwgewgsltayssdw
qsgeywvkktstdfetmnmdtgalqpgpaylafplcalsi

SCOPe Domain Coordinates for d1cwva5:

Click to download the PDB-style file with coordinates for d1cwva5.
(The format of our PDB-style files is described here.)

Timeline for d1cwva5: