SCOPe 2.03: Domain d1e5ui2: 1e5u I:90-187

Lineage for d1e5ui2 (1e5u I:90-187)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins)
   automatically mapped to Pfam PF07979

6. Protein Intimin [56473] (1 species)

7. Species Escherichia coli [TaxId:562] [56474] (3 PDB entries)
   an enteropathogenic serotype

8. Domain d1e5ui2: 1e5u I:90-187 [42441]
   Other proteins in same PDB: d1e5ui1

Details for d1e5ui2

PDB Entry: 1e5u

PDB Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli

PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1e5ui2:

Sequence; same for both SEQRES and ATOM records:

>d1e5ui2 d.169.1.3 (I:90-187) Intimin {Escherichia coli [TaxId: 562]}
livpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtiiswvq
qtaqdaksgvastydlvkqnplnnikasesnayatcvk

Timeline for d1e5ui2:

• d1e5ui2 first appeared (with stable ids) in SCOP 1.55
  
• d1e5ui2 appears in SCOPe 2.02
  
• d1e5ui2 appears in SCOPe 2.04
  
• d1e5ui2 appears in the current release, SCOPe 2.08