Lineage for d1f02i3 (1f02 I:842-939)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226778Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins)
  6. 1226779Protein Intimin [56473] (1 species)
  7. 1226780Species Escherichia coli [TaxId:562] [56474] (3 PDB entries)
    an enteropathogenic serotype
  8. 1226782Domain d1f02i3: 1f02 I:842-939 [42440]
    Other proteins in same PDB: d1f02i1, d1f02i2, d1f02t_

Details for d1f02i3

PDB Entry: 1f02 (more details), 2.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of intimin in complex with translocated intimin receptor (tir) intimin-binding domain
PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1f02i3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f02i3 d.169.1.3 (I:842-939) Intimin {Escherichia coli [TaxId: 562]}
livpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtiiswvq
qtaqdaksgvastydlvkqnplnnikasesnayatcvk

SCOPe Domain Coordinates for d1f02i3:

Click to download the PDB-style file with coordinates for d1f02i3.
(The format of our PDB-style files is described here.)

Timeline for d1f02i3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f02t_