| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins) |
| Protein Intimin [56473] (1 species) |
| Species Escherichia coli [TaxId:562] [56474] (3 PDB entries) an enteropathogenic serotype |
| Domain d1f02i3: 1f02 I:842-939 [42440] Other proteins in same PDB: d1f02i1, d1f02i2, d1f02t_ |
PDB Entry: 1f02 (more details), 2.9 Å
SCOPe Domain Sequences for d1f02i3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f02i3 d.169.1.3 (I:842-939) Intimin {Escherichia coli [TaxId: 562]}
livpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtiiswvq
qtaqdaksgvastydlvkqnplnnikasesnayatcvk
Timeline for d1f02i3: