Lineage for d1preb1 (1pre B:2-84)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85746Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)
  6. 85761Protein Proaerolysin, N-terminal domain [56470] (1 species)
  7. 85762Species Aeromonas hydrophila [56471] (1 PDB entry)
  8. 85764Domain d1preb1: 1pre B:2-84 [42438]
    Other proteins in same PDB: d1prea2, d1preb2

Details for d1preb1

PDB Entry: 1pre (more details), 2.8 Å

PDB Description: proaerolysin

SCOP Domain Sequences for d1preb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1preb1 d.169.1.2 (B:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila}
epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
ngeikpgtasntwcyptnpvtge

SCOP Domain Coordinates for d1preb1:

Click to download the PDB-style file with coordinates for d1preb1.
(The format of our PDB-style files is described here.)

Timeline for d1preb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1preb2