SCOP 1.55: Domain d1preb1: 1pre B:2-84

Lineage for d1preb1 (1pre B:2-84)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)

6. Protein Proaerolysin, N-terminal domain [56470] (1 species)

7. Species Aeromonas hydrophila [56471] (1 PDB entry)

8. Domain d1preb1: 1pre B:2-84 [42438]
   Other proteins in same PDB: d1prea2, d1preb2

Details for d1preb1

PDB Entry: 1pre, 2.8 Å

PDB Description: proaerolysin

SCOP Domain Sequences for d1preb1:

Sequence; same for both SEQRES and ATOM records:

>d1preb1 d.169.1.2 (B:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila}
epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
ngeikpgtasntwcyptnpvtge

Timeline for d1preb1:

• d1preb1 appears in SCOP 1.57
  
• d1preb1 appears in the current release, SCOPe 2.08