![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
![]() | Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins) |
![]() | Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species) |
![]() | Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries) |
![]() | Domain d1ptoh2: 1pto H:2-89 [42435] Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptoc1, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh1, d1ptoi1, d1ptoj_, d1ptok_, d1ptol_ |
PDB Entry: 1pto (more details), 3.5 Å
SCOP Domain Sequences for d1ptoh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptoh2 d.169.1.2 (H:2-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis} tpgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgt ylggeyggvikdgtpggafdlkttfcim
Timeline for d1ptoh2: