Lineage for d1ptob2 (1pto B:4-89)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235169Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)
    automatically mapped to Pfam PF03440
  6. 2235170Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species)
  7. 2235171Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries)
  8. 2235180Domain d1ptob2: 1pto B:4-89 [42433]
    Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptoc1, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh1, d1ptoi1, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptob2

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
PDB Compounds: (B:) pertussis toxin

SCOPe Domain Sequences for d1ptob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptob2 d.169.1.2 (B:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]}
givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl
ggeyggvikdgtpggafdlkttfcim

SCOPe Domain Coordinates for d1ptob2:

Click to download the PDB-style file with coordinates for d1ptob2.
(The format of our PDB-style files is described here.)

Timeline for d1ptob2: