Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins) automatically mapped to Pfam PF03440 |
Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species) |
Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries) |
Domain d1ptob2: 1pto B:4-89 [42433] Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptoc1, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh1, d1ptoi1, d1ptoj_, d1ptok_, d1ptol_ |
PDB Entry: 1pto (more details), 3.5 Å
SCOPe Domain Sequences for d1ptob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptob2 d.169.1.2 (B:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]} givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl ggeyggvikdgtpggafdlkttfcim
Timeline for d1ptob2: