SCOPe 2.07: Domain d1prtc2: 1prt C:4-89

Lineage for d1prtc2 (1prt C:4-89)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins)
   automatically mapped to Pfam PF03440

6. Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species)

7. Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries)

8. Domain d1prtc2: 1prt C:4-89 [42426]
   Other proteins in same PDB: d1prta_, d1prtb1, d1prtc1, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth1, d1prti1, d1prtj_, d1prtk_, d1prtl_

Details for d1prtc2

PDB Entry: 1prt, 2.9 Å

PDB Description: the crystal structure of pertussis toxin

PDB Compounds: (C:) pertussis toxin (subunit s3)

SCOPe Domain Sequences for d1prtc2:

Sequence; same for both SEQRES and ATOM records:

>d1prtc2 d.169.1.2 (C:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]}
givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
gqayggiikdappgagfiyretfcit

Timeline for d1prtc2:

• d1prtc2 first appeared (with stable ids) in SCOP 1.55
  
• d1prtc2 appears in SCOPe 2.06
  
• d1prtc2 appears in the current release, SCOPe 2.08