SCOPe 2.05: Domain d1htna1: 1htn A:54-181

Lineage for d1htna1 (1htn A:54-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Tetranectin [56465] (1 species)
   trimeric plasminogen binding protein with an alpha-helical coiled coil

7. Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
   Uniprot P05452 85-202

8. Domain d1htna1: 1htn A:54-181 [42424]
   Other proteins in same PDB: d1htna2
   complexed with ca

Details for d1htna1

PDB Entry: 1htn, 2.8 Å

PDB Description: human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil

PDB Compounds: (A:) tetranectin

SCOPe Domain Sequences for d1htna1:

Sequence; same for both SEQRES and ATOM records:

>d1htna1 d.169.1.1 (A:54-181) Tetranectin {Human (Homo sapiens) [TaxId: 9606]}
tkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlg
lndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlp
yicqfgiv

Timeline for d1htna1:

• d1htna1 first appeared (with stable ids) in SCOP 1.55, called d1htn_1
  
• d1htna1 appears in SCOPe 2.04
  
• d1htna1 appears in SCOPe 2.06
  
• d1htna1 appears in the current release, SCOPe 2.08