Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Tetranectin [56465] (1 species) trimeric plasminogen binding protein with an alpha-helical coiled coil |
Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries) Uniprot P05452 85-202 |
Domain d1htna1: 1htn A:54-181 [42424] Other proteins in same PDB: d1htna2 complexed with ca |
PDB Entry: 1htn (more details), 2.8 Å
SCOPe Domain Sequences for d1htna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htna1 d.169.1.1 (A:54-181) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} tkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlg lndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlp yicqfgiv
Timeline for d1htna1: