Lineage for d1htna1 (1htn A:54-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878407Protein Tetranectin [56465] (1 species)
    trimeric plasminogen binding protein with an alpha-helical coiled coil
  7. 878408Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
    Uniprot P05452 85-202
  8. 878410Domain d1htna1: 1htn A:54-181 [42424]
    Other proteins in same PDB: d1htna2
    complexed with ca

Details for d1htna1

PDB Entry: 1htn (more details), 2.8 Å

PDB Description: human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil
PDB Compounds: (A:) tetranectin

SCOP Domain Sequences for d1htna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htna1 d.169.1.1 (A:54-181) Tetranectin {Human (Homo sapiens) [TaxId: 9606]}
tkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlg
lndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlp
yicqfgiv

SCOP Domain Coordinates for d1htna1:

Click to download the PDB-style file with coordinates for d1htna1.
(The format of our PDB-style files is described here.)

Timeline for d1htna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htna2