SCOP 1.71: Domain d1htn_1: 1htn 54-181

Lineage for d1htn_1 (1htn 54-181)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Tetranectin [56465] (1 species)
   trimeric plasminogen binding protein with an alpha-helical coiled coil

7. Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)

8. Domain d1htn_1: 1htn 54-181 [42424]
   Other proteins in same PDB: d1htn_2
   complexed with ca

Details for d1htn_1

PDB Entry: 1htn, 2.8 Å

PDB Description: human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil

SCOP Domain Sequences for d1htn_1:

Sequence; same for both SEQRES and ATOM records:

>d1htn_1 d.169.1.1 (54-181) Tetranectin {Human (Homo sapiens)}
tkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlg
lndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlp
yicqfgiv

Timeline for d1htn_1:

• d1htn_1 first appeared (with stable ids) in SCOP 1.55
  
• d1htn_1 appears in SCOP 1.69
  
• d1htn_1 is called d1htna1 in SCOP 1.73
  
• d1htn_1 appears in the current release, SCOPe 2.08, called d1htna1