Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein Tetranectin [56465] (1 species) trimeric plasminogen binding protein with an alpha-helical coiled coil |
Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries) |
Domain d1htn_1: 1htn 54-181 [42424] Other proteins in same PDB: d1htn_2 complexed with ca |
PDB Entry: 1htn (more details), 2.8 Å
SCOP Domain Sequences for d1htn_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htn_1 d.169.1.1 (54-181) Tetranectin {Human (Homo sapiens)} tkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlg lndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlp yicqfgiv
Timeline for d1htn_1: