SCOP 1.71: Domain d1tn3__: 1tn3 -

Lineage for d1tn3__ (1tn3 -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Tetranectin [56465] (1 species)
   trimeric plasminogen binding protein with an alpha-helical coiled coil

7. Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)

8. Domain d1tn3__: 1tn3 - [42423]
   complexed with ca, eoh, so4

Details for d1tn3__

PDB Entry: 1tn3, 2 Å

PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin

PDB Compounds: ( :)

SCOP Domain Sequences for d1tn3__:

Sequence; same for both SEQRES and ATOM records:

>d1tn3__ d.169.1.1 (-) Tetranectin {Human (Homo sapiens)}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv

Timeline for d1tn3__:

• d1tn3__ first appeared (with stable ids) in SCOP 1.55
  
• d1tn3__ appears in SCOP 1.69
  
• d1tn3__ is called d1tn3a_ in SCOP 1.73
  
• d1tn3__ appears in the current release, SCOPe 2.07, called d1tn3a_