Lineage for d1tn3__ (1tn3 -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614649Protein Tetranectin [56465] (1 species)
    trimeric plasminogen binding protein with an alpha-helical coiled coil
  7. 614650Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
  8. 614651Domain d1tn3__: 1tn3 - [42423]
    complexed with ca, eoh, so4

Details for d1tn3__

PDB Entry: 1tn3 (more details), 2 Å

PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin
PDB Compounds: ( :)

SCOP Domain Sequences for d1tn3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn3__ d.169.1.1 (-) Tetranectin {Human (Homo sapiens)}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv

SCOP Domain Coordinates for d1tn3__:

Click to download the PDB-style file with coordinates for d1tn3__.
(The format of our PDB-style files is described here.)

Timeline for d1tn3__: