Lineage for d1tn3__ (1tn3 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Tetranectin [56465] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56466] (2 PDB entries) 
Domain d1tn3__: 1tn3 - [42423]
Details for d1tn3__
PDB Entry: 1tn3 (more details), 2 Å
PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin
SCOP Domain Sequences for d1tn3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tn3__ d.169.1.1 (-) Tetranectin {Human (Homo sapiens)}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv
SCOP Domain Coordinates for d1tn3__:
Click to download the PDB-style file with coordinates for d1tn3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tn3__:
- d1tn3__ appears in SCOP 1.57
- d1tn3__ appears in the current release, SCOPe 2.08, called d1tn3a_
View in 3D