Lineage for d1tn3__ (1tn3 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37449Protein Tetranectin [56465] (1 species)
  7. 37450Species Human (Homo sapiens) [TaxId:9606] [56466] (2 PDB entries)
  8. 37451Domain d1tn3__: 1tn3 - [42423]

Details for d1tn3__

PDB Entry: 1tn3 (more details), 2 Å

PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin

SCOP Domain Sequences for d1tn3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn3__ d.169.1.1 (-) Tetranectin {Human (Homo sapiens)}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv

SCOP Domain Coordinates for d1tn3__:

Click to download the PDB-style file with coordinates for d1tn3__.
(The format of our PDB-style files is described here.)

Timeline for d1tn3__: