SCOPe 2.08: Domain d1tlgb_: 1tlg B:

Lineage for d1tlgb_ (1tlg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Lectin TC14 [56463] (1 species)

7. Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries)

8. Domain d1tlgb_: 1tlg B: [42422]
   complexed with ca, gal, zn

Details for d1tlgb_

PDB Entry: 1tlg, 2.2 Å

PDB Description: structure of a tunicate c-type lectin complexed with d-galactose

PDB Compounds: (B:) polyandrocarpa lectin

SCOPe Domain Sequences for d1tlgb_:

Sequence; same for both SEQRES and ATOM records:

>d1tlgb_ d.169.1.1 (B:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld

Timeline for d1tlgb_:

• d1tlgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tlgb_ appears in SCOPe 2.07