![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (3 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries) |
![]() | Domain d1b08c1: 1b08 C:2235-2355 [42418] Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2 complexed with ca |
PDB Entry: 1b08 (more details), 2.3 Å
SCOPe Domain Sequences for d1b08c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b08c1 d.169.1.1 (C:2235-2355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d1b08c1:
![]() Domains from other chains: (mouse over for more information) d1b08a1, d1b08a2, d1b08b1, d1b08b2 |