| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (24 proteins) Pfam 00059 |
| Protein Surfactant protein, lectin domain [56461] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries) |
| Domain d1b08b1: 1b08 B:1235-1355 [42417] Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2 |
PDB Entry: 1b08 (more details), 2.3 Å
SCOP Domain Sequences for d1b08b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b08b1 d.169.1.1 (B:1235-1355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f
Timeline for d1b08b1:
View in 3DDomains from other chains: (mouse over for more information) d1b08a1, d1b08a2, d1b08c1, d1b08c2 |