Lineage for d1b08a1 (1b08 A:235-355)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878360Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 878361Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)
  8. 878401Domain d1b08a1: 1b08 A:235-355 [42416]
    Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2

Details for d1b08a1

PDB Entry: 1b08 (more details), 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)
PDB Compounds: (A:) protein (lung surfactant protein d)

SCOP Domain Sequences for d1b08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b08a1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1b08a1:

Click to download the PDB-style file with coordinates for d1b08a1.
(The format of our PDB-style files is described here.)

Timeline for d1b08a1: