SCOP 1.65: Domain d1msba_: 1msb A:

Lineage for d1msba_ (1msb A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1msba_: 1msb A: [42414]

Details for d1msba_

PDB Entry: 1msb, 2.3 Å

PDB Description: structure of the calcium-dependent lectin domain from a rat mannose-binding protein determined by mad phasing

SCOP Domain Sequences for d1msba_:

Sequence; same for both SEQRES and ATOM records:

>d1msba_ d.169.1.1 (A:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1msba_:

• d1msba_ first appeared (with stable ids) in SCOP 1.55
  
• d1msba_ appears in SCOP 1.63
  
• d1msba_ appears in SCOP 1.67
  
• d1msba_ appears in the current release, SCOPe 2.08