SCOP 1.57: Domain d1bcj11: 1bcj 1:105-226

Lineage for d1bcj11 (1bcj 1:105-226)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (15 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)

8. Domain d1bcj11: 1bcj 1:105-226 [42411]
   Other proteins in same PDB: d1bcj12, d1bcj22, d1bcj32

Details for d1bcj11

PDB Entry: 1bcj, 2.1 Å

PDB Description: mannose-binding protein-a mutant (qpdwghv) complexed with n-acetyl-d- galactosamine

SCOP Domain Sequences for d1bcj11:

Sequence; same for both SEQRES and ATOM records:

>d1bcj11 d.169.1.1 (1:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktvaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa

Timeline for d1bcj11:

• d1bcj11 first appeared (with stable ids) in SCOP 1.55
  
• d1bcj11 appears in SCOP 1.59
  
• d1bcj11 appears in the current release, SCOPe 2.08