Lineage for d1kmb31 (1kmb 3:105-221)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514429Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 514432Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 514519Domain d1kmb31: 1kmb 3:105-221 [42407]
    Other proteins in same PDB: d1kmb12, d1kmb22, d1kmb32

Details for d1kmb31

PDB Entry: 1kmb (more details), 2.1 Å

PDB Description: selectin-like mutant of mannose-binding protein a

SCOP Domain Sequences for d1kmb31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmb31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

SCOP Domain Coordinates for d1kmb31:

Click to download the PDB-style file with coordinates for d1kmb31.
(The format of our PDB-style files is described here.)

Timeline for d1kmb31: