| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1kmb21: 1kmb 2:105-221 [42406] Other proteins in same PDB: d1kmb12, d1kmb22, d1kmb32 complexed with ca, cl; mutant |
PDB Entry: 1kmb (more details), 2.1 Å
SCOPe Domain Sequences for d1kmb21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d1kmb21:
View in 3DDomains from other chains: (mouse over for more information) d1kmb11, d1kmb12, d1kmb31, d1kmb32 |