| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (24 proteins) Pfam 00059 |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1fihc1: 1fih C:105-226 [42398] Other proteins in same PDB: d1fiha2, d1fihb2, d1fihc2 |
PDB Entry: 1fih (more details), 1.95 Å
SCOP Domain Sequences for d1fihc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fihc1 d.169.1.1 (C:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa
Timeline for d1fihc1:
View in 3DDomains from other chains: (mouse over for more information) d1fiha1, d1fiha2, d1fihb1, d1fihb2 |