Lineage for d1fihb1 (1fih B:105-226)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614429Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 614432Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 614506Domain d1fihb1: 1fih B:105-226 [42397]
    Other proteins in same PDB: d1fiha2, d1fihb2, d1fihc2

Details for d1fihb1

PDB Entry: 1fih (more details), 1.95 Å

PDB Description: n-acetylgalactosamine binding mutant of mannose-binding protein a (qpdwg-hdrpy), complex with n-acetylgalactosamine

SCOP Domain Sequences for d1fihb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fihb1 d.169.1.1 (B:105-226) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa

SCOP Domain Coordinates for d1fihb1:

Click to download the PDB-style file with coordinates for d1fihb1.
(The format of our PDB-style files is described here.)

Timeline for d1fihb1: