| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) | 
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold  | 
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]()  | 
| Family d.169.1.1: C-type lectin domain [56437] (22 proteins) | 
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) | 
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
| Domain d4kmb21: 4kmb 2:105-221 [42394] Other proteins in same PDB: d4kmb12, d4kmb22, d4kmb32  | 
PDB Entry: 4kmb (more details), 2 Å
SCOP Domain Sequences for d4kmb21:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d4kmb21:
 View in 3DDomains from other chains: (mouse over for more information) d4kmb11, d4kmb12, d4kmb31, d4kmb32  |