SCOP 1.69: Domain d3kmb31: 3kmb 3:105-221

Lineage for d3kmb31 (3kmb 3:105-221)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
   Pfam 00059

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d3kmb31: 3kmb 3:105-221 [42392]
   Other proteins in same PDB: d3kmb12, d3kmb22, d3kmb32

Details for d3kmb31

PDB Entry: 3kmb, 1.95 Å

PDB Description: complex of 3'-sulfo-lewis-x with a selectin-like mutant of mannose- binding protein a

SCOP Domain Sequences for d3kmb31:

Sequence; same for both SEQRES and ATOM records:

>d3kmb31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

Timeline for d3kmb31:

• d3kmb31 first appeared (with stable ids) in SCOP 1.55
  
• d3kmb31 appears in SCOP 1.67
  
• d3kmb31 appears in SCOP 1.71
  
• d3kmb31 appears in the current release, SCOPe 2.08