SCOP 1.65: Domain d2kmb21: 2kmb 2:105-221

Lineage for d2kmb21 (2kmb 2:105-221)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d2kmb21: 2kmb 2:105-221 [42388]
   Other proteins in same PDB: d2kmb12, d2kmb22, d2kmb32

Details for d2kmb21

PDB Entry: 2kmb, 2 Å

PDB Description: complex of 3'-neuac-lewis-x with a selectin-like mutant of mannose- binding protein a

SCOP Domain Sequences for d2kmb21:

Sequence; same for both SEQRES and ATOM records:

>d2kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

Timeline for d2kmb21:

• d2kmb21 first appeared (with stable ids) in SCOP 1.55
  
• d2kmb21 appears in SCOP 1.63
  
• d2kmb21 appears in SCOP 1.67
  
• d2kmb21 appears in the current release, SCOPe 2.08