SCOP 1.73: Domain d2kmb11: 2kmb 1:105-221

Lineage for d2kmb11 (2kmb 1:105-221)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d2kmb11: 2kmb 1:105-221 [42387]
   Other proteins in same PDB: d2kmb12, d2kmb22, d2kmb32

Details for d2kmb11

PDB Entry: 2kmb, 2 Å

PDB Description: complex of 3'-neuac-lewis-x with a selectin-like mutant of mannose- binding protein a

PDB Compounds: (1:) mannose-binding protein-a

SCOP Domain Sequences for d2kmb11:

Sequence; same for both SEQRES and ATOM records:

>d2kmb11 d.169.1.1 (1:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

Timeline for d2kmb11:

• d2kmb11 first appeared (with stable ids) in SCOP 1.55
  
• d2kmb11 appears in SCOP 1.71
  
• d2kmb11 appears in SCOP 1.75
  
• d2kmb11 appears in the current release, SCOPe 2.08