Lineage for d1bv4b_ (1bv4 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85602Family d.169.1.1: C-type lectin domain [56437] (15 proteins)
  6. 85638Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 85641Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)
  8. 85671Domain d1bv4b_: 1bv4 B: [42381]

Details for d1bv4b_

PDB Entry: 1bv4 (more details), 1.85 Å

PDB Description: apo-mannose-binding protein-c

SCOP Domain Sequences for d1bv4b_:

Sequence, based on SEQRES records: (download)

>d1bv4b_ d.169.1.1 (B:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd

Sequence, based on observed residues (ATOM records): (download)

>d1bv4b_ d.169.1.1 (B:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtvfedl
tgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd

SCOP Domain Coordinates for d1bv4b_:

Click to download the PDB-style file with coordinates for d1bv4b_.
(The format of our PDB-style files is described here.)

Timeline for d1bv4b_: