| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (24 proteins) Pfam 00059 |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1rdm2_: 1rdm 2: [42379] |
PDB Entry: 1rdm (more details), 1.9 Å
SCOP Domain Sequences for d1rdm2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rdm2_ d.169.1.1 (2:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Timeline for d1rdm2_: