Lineage for d1rdm1_ (1rdm 1:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336839Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 336842Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 336875Domain d1rdm1_: 1rdm 1: [42378]

Details for d1rdm1_

PDB Entry: 1rdm (more details), 1.9 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with alpha-methyl-d-mannopyranoside (1.3 m)

SCOP Domain Sequences for d1rdm1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdm1_ d.169.1.1 (1:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1rdm1_:

Click to download the PDB-style file with coordinates for d1rdm1_.
(The format of our PDB-style files is described here.)

Timeline for d1rdm1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rdm2_