SCOP 1.69: Domain d1fifb1: 1fif B:105-226

Lineage for d1fifb1 (1fif B:105-226)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
   Pfam 00059

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1fifb1: 1fif B:105-226 [42374]
   Other proteins in same PDB: d1fifa2, d1fifb2, d1fifc2

Details for d1fifb1

PDB Entry: 1fif, 1.95 Å

PDB Description: n-acetylgalactosamine-selective mutant of mannose-binding protein-a (qpdwg-hdrpy)

SCOP Domain Sequences for d1fifb1:

Sequence; same for both SEQRES and ATOM records:

>d1fifb1 d.169.1.1 (B:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa

Timeline for d1fifb1:

• d1fifb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fifb1 appears in SCOP 1.67
  
• d1fifb1 appears in SCOP 1.71
  
• d1fifb1 appears in the current release, SCOPe 2.08