| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1fifa1: 1fif A:105-226 [42373] Other proteins in same PDB: d1fifa2, d1fifb2, d1fifc2 complexed with ca, cl; mutant |
PDB Entry: 1fif (more details), 1.95 Å
SCOPe Domain Sequences for d1fifa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fifa1 d.169.1.1 (A:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa
Timeline for d1fifa1:
View in 3DDomains from other chains: (mouse over for more information) d1fifb1, d1fifb2, d1fifc1, d1fifc2 |