|  | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (6 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (21 proteins) | 
|  | Protein Mannose-binding protein A, lectin domain [56458] (2 species) | 
|  | Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
|  | Domain d1rdn2_: 1rdn 2: [42372] complexed with ca, cl, mag | 
PDB Entry: 1rdn (more details), 1.8 Å
SCOP Domain Sequences for d1rdn2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rdn2_ d.169.1.1 (2:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Timeline for d1rdn2_: