Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
Domain d1rdj2_: 1rdj 2: [42370] complexed with ca, cl, mfb |
PDB Entry: 1rdj (more details), 1.8 Å
SCOPe Domain Sequences for d1rdj2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rdj2_ d.169.1.1 (2:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Timeline for d1rdj2_: