SCOP 1.65: Domain d1rdl1_: 1rdl 1:

Lineage for d1rdl1_ (1rdl 1:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1rdl1_: 1rdl 1: [42359]

Details for d1rdl1_

PDB Entry: 1rdl, 1.7 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with alpha-methyl-d-mannopyranoside (0.2 m)

SCOP Domain Sequences for d1rdl1_:

Sequence; same for both SEQRES and ATOM records:

>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Timeline for d1rdl1_:

• d1rdl1_ first appeared (with stable ids) in SCOP 1.55
  
• d1rdl1_ appears in SCOP 1.63
  
• d1rdl1_ appears in SCOP 1.67
  
• d1rdl1_ appears in the current release, SCOPe 2.08