SCOP 1.73: Domain d2msbb_: 2msb B:

Lineage for d2msbb_ (2msb B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d2msbb_: 2msb B: [42356]
   complexed with ca, man, nag

Details for d2msbb_

PDB Entry: 2msb, 1.7 Å

PDB Description: structure of a c-type mannose-binding protein complexed with an oligosaccharide

PDB Compounds: (B:) mannose-binding protein-a

SCOP Domain Sequences for d2msbb_:

Sequence; same for both SEQRES and ATOM records:

>d2msbb_ d.169.1.1 (B:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]}
kkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegqf
myvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d2msbb_:

• d2msbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2msbb_ appears in SCOP 1.71
  
• d2msbb_ appears in SCOP 1.75
  
• d2msbb_ appears in the current release, SCOPe 2.08