Lineage for d2msbb_ (2msb B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85602Family d.169.1.1: C-type lectin domain [56437] (15 proteins)
  6. 85638Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 85641Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)
  8. 85643Domain d2msbb_: 2msb B: [42356]

Details for d2msbb_

PDB Entry: 2msb (more details), 1.7 Å

PDB Description: structure of a c-type mannose-binding protein complexed with an oligosaccharide

SCOP Domain Sequences for d2msbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msbb_ d.169.1.1 (B:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegqf
myvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d2msbb_:

Click to download the PDB-style file with coordinates for d2msbb_.
(The format of our PDB-style files is described here.)

Timeline for d2msbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2msba_