SCOPe 2.06: Domain d2msba_: 2msb A:

Lineage for d2msba_ (2msb A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d2msba_: 2msb A: [42355]
   complexed with ca

Details for d2msba_

PDB Entry: 2msb, 1.7 Å

PDB Description: structure of a c-type mannose-binding protein complexed with an oligosaccharide

PDB Compounds: (A:) mannose-binding protein-a

SCOPe Domain Sequences for d2msba_:

Sequence; same for both SEQRES and ATOM records:

>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegqf
myvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefp

Timeline for d2msba_:

• d2msba_ first appeared (with stable ids) in SCOP 1.55
  
• d2msba_ appears in SCOPe 2.05
  
• d2msba_ appears in SCOPe 2.07
  
• d2msba_ appears in the current release, SCOPe 2.08