SCOPe 2.07: Domain d1hupa1: 1hup A:112-228

Lineage for d1hupa1 (1hup A:112-228)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56459] (1 PDB entry)

8. Domain d1hupa1: 1hup A:112-228 [42354]
   Other proteins in same PDB: d1hupa2
   complexed with ca, so4

Details for d1hupa1

PDB Entry: 1hup, 2.5 Å

PDB Description: human mannose binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil

PDB Compounds: (A:) mannose-binding protein

SCOPe Domain Sequences for d1hupa1:

Sequence; same for both SEQRES and ATOM records:

>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
kqvgnkffltngeimtfekvkalcvkfqasvatprnaaengaiqnlikeeaflgitdekt
egqfvdltgnrltytnwnegepnnagsdedcvlllkngqwndvpcstshlavcefpi

Timeline for d1hupa1:

• d1hupa1 first appeared (with stable ids) in SCOP 1.55, called d1hup_1
  
• d1hupa1 appears in SCOPe 2.06
  
• d1hupa1 appears in the current release, SCOPe 2.08