Lineage for d1esla1 (1esl A:1-118)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682121Protein E-selectin, C-lectin domain [56456] (1 species)
    folowed by EGF-like module
  7. 1682122Species Human (Homo sapiens) [TaxId:9606] [56457] (2 PDB entries)
  8. 1682124Domain d1esla1: 1esl A:1-118 [42353]
    Other proteins in same PDB: d1esla2
    complexed with ca, cl

Details for d1esla1

PDB Entry: 1esl (more details), 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains
PDB Compounds: (A:) human e-selectin

SCOPe Domain Sequences for d1esla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esla1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy

SCOPe Domain Coordinates for d1esla1:

Click to download the PDB-style file with coordinates for d1esla1.
(The format of our PDB-style files is described here.)

Timeline for d1esla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1esla2