SCOP 1.57: Domain d1esl_1: 1esl 1-118

Lineage for d1esl_1 (1esl 1-118)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (15 proteins)

6. Protein E-selectin [56456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56457] (1 PDB entry)

8. Domain d1esl_1: 1esl 1-118 [42353]
   Other proteins in same PDB: d1esl_2

Details for d1esl_1

PDB Entry: 1esl, 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains

SCOP Domain Sequences for d1esl_1:

Sequence; same for both SEQRES and ATOM records:

>d1esl_1 d.169.1.1 (1-118) E-selectin {Human (Homo sapiens)}
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcy

Timeline for d1esl_1:

• d1esl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1esl_1 appears in SCOP 1.59
  
• d1esl_1 appears in the current release, SCOPe 2.08, called d1esla1