Lineage for d1dv8a_ (1dv8 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614399Protein H1 subunit of the asialoglycoprotein receptor [56454] (1 species)
  7. 614400Species Human (Homo sapiens) [TaxId:9606] [56455] (1 PDB entry)
  8. 614401Domain d1dv8a_: 1dv8 A: [42352]
    complexed with ca, cl

Details for d1dv8a_

PDB Entry: 1dv8 (more details), 2.3 Å

PDB Description: crystal structure of the carbohydrate recognition domain of the h1 subunit of the asialoglycoprotein receptor

SCOP Domain Sequences for d1dv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens)}
cpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwmg
lhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrpy
rwvcetel

SCOP Domain Coordinates for d1dv8a_:

Click to download the PDB-style file with coordinates for d1dv8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dv8a_: