Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein H1 subunit of the asialoglycoprotein receptor [56454] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56455] (1 PDB entry) |
Domain d1dv8a_: 1dv8 A: [42352] complexed with ca, cl |
PDB Entry: 1dv8 (more details), 2.3 Å
SCOP Domain Sequences for d1dv8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens)} cpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwmg lhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrpy rwvcetel
Timeline for d1dv8a_: