Lineage for d1fvud_ (1fvu D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514592Protein Snake coagglutinin beta chain [88867] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 514602Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (2 PDB entries)
  8. 514604Domain d1fvud_: 1fvu D: [42348]
    Other proteins in same PDB: d1fvua_, d1fvuc_

Details for d1fvud_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin

SCOP Domain Sequences for d1fvud_:

Sequence, based on SEQRES records: (download)

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records): (download)

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
a

SCOP Domain Coordinates for d1fvud_:

Click to download the PDB-style file with coordinates for d1fvud_.
(The format of our PDB-style files is described here.)

Timeline for d1fvud_: